Regulatory Th2-type T cell lines against insulin and GAD peptides derived from orally- and nasally-treated NOD mice suppress diabetes. NLM AIDSLINE Important note: Information in this article was accurate in 1999. The state of the art may have changed since the publication date.

Click here to return to AIDSLINE main menu
DonateNow
Print this Article


Regulatory Th2-type T cell lines against insulin and GAD peptides derived from orally- and nasally-treated NOD mice suppress diabetes.

J Autoimmun. 1999 Jun;12(4):251-8. Unique Identifier : AIDSLINE MED/99264266
Maron R; Melican NS; Weiner HL; Brigham and Women's Hospital and Harvard Medical School, Center; for Neurologic Diseases, 77 Avenue Louis Pasteur, Boston, MA; 02115, USA.


Abstract: Non-obese diabetic (NOD) mice spontaneously develop diabetes. Ourselves and others have previously shown that oral and nasal administration of insulin or glutamic acid decarboxylase (GAD) suppresses development of diabetes in the NOD mouse and that this suppression appears secondary to the generation of regulatory T cells that act by secreting anti-inflammatory cytokines such as IL-4 and TGF-beta. In the present study, we analysed cytokine patterns associated with mucosal administration of insulin B-chain, B-chain peptide 10-24 and GAD peptide 524-543 and derived lines and clones from mucosally-treated animals. Mice were fed five times (400-600 microg/feed) or nasally-treated three times (60 microg/application), and 2 days after the last treatment were immunized in the footpad with the mucosally administered antigen in CFA. Primary immune responses in the popliteal lymph node were measured 10 days after immunization and lines and clones were then established from the primary cultures. There was significantly less IFN-gamma production in mucosally-treated mice associated with increased production of IL-10 and TGF-beta. The nature of the antigen appeared to determine cytokine production as the B-chain given either orally or nasally primed for TGF-beta responses, whereas mucosally administered B-chain peptide 10-24 primed for IL-10. T cell clones, established from draining lymph nodes of fed or nasally-treated animals, secreted IL-4, IL-10 and TGF-beta whereas those from non-fed mice secreted IL-2 and IFN-gamma. Transfer of Th1 lines with splenocytes from diabetic NOD mice into NOD or NOD/SCID animals accelerated diabetes, whereas transfer of Th2 lines suppressed the development of diabetes. Our results further support a role for Th2-type cells in the regulation of diabetes in NOD mice. Copyright 1999 Academic Press.
Keywords: JOURNAL ARTICLE Administration, Intranasal Administration, Oral Adoptive Transfer Animal Cell Line Cytokines/BIOSYNTHESIS Diabetes Mellitus, Insulin-Dependent/*PREVENTION & CONTROL Female Glutamate Decarboxylase/*IMMUNOLOGY Immunization Insulin/*IMMUNOLOGY Mice Mice, Inbred NOD Peptide Fragments/IMMUNOLOGY Support, Non-U.S. Gov't Th1 Cells/PHYSIOLOGY Th2 Cells/*PHYSIOLOGYKWDjournalarticleadministration,intranasaladministration,oraladoptivetransferanimalcelllinecytokines/biosynthesisdiabetesmellitus,insulin-dependent/KWDprevention&controlfemaleglutamatedecarboxylase/KWDimmunologyimmunizationinsulin/KWDimmunologymicemice,inbrednodpeptidefragments/immunologysupport,non-uKWDsKWDgov'tth1cells/physiologyth2cells/KWDphysiology
990930
A9991376

Copyright © 1999 - National Library of Medicine. Reproduced under license with the National Library of Medicine, Bethesda, MD.

AEGiS is a 501(c)3, not-for-profit, tax-exempt, educational corporation. AEGiS is made possible through unrestricted funding from Boehringer Ingelheim, Bridgestone/Firestone Charitable Trust, Bristol-Myers Squibb Company, Elton John AIDS Foundation, Gill Foundation, the National Library of Medicine, Quest Diagnostics, Roche and Trimeris, and donations from users like you. Always watch for outdated information. This article first appeared in 1999. This material is designed to support, not replace, the relationship that exists between you and your doctor.

AEGiS presents published material, reprinted with permission and neither endorses nor opposes any material. All information contained on this website, including information relating to health conditions, products, and treatments, is for informational purposes only. It is often presented in summary or aggregate form. It is not meant to be a substitute for the advice provided by your own physician or other medical professionals. Always discuss treatment options with a doctor who specializes in treating HIV.

Copyright ©1980, 1999. AEGiS. All materials appearing on AEGiS are protected by copyright as a collective work or compilation under U.S. copyright and other laws and are the property of AEGiS, or the party credited as the provider of the content. .