Bovine insulin and porcine or human insulin prime distinct CD4(+) T cell subsets in C57BL/6 mice. NLM AIDSLINE Important note: Information in this article was accurate in 1999. The state of the art may have changed since the publication date.

Click here to return to AIDSLINE main menu
DonateNow
Print this Article


Bovine insulin and porcine or human insulin prime distinct CD4(+) T cell subsets in C57BL/6 mice.

Cell Immunol. 1999 Jul 10;195(1):66-74. Unique Identifier : AIDSLINE MED/99365234
Long SA; Zimecki M; Kapp JA; Department of Ophthalmology, Emory University, Atlanta, Georgia,; 30322, USA.


Abstract: H-2(b) mice produce insulin-specific antibody when injected with bovine but not porcine or human insulin. Nevertheless, CD4(+) T cells have been cloned from C57BL/6 mice primed with porcine, human, and bovine insulin. Here we tested the hypothesis that CD4(+) T cells from C57BL/6 mice primed with porcine or human insulin are functionally distinct from those primed with bovine insulin. Our results show that variants of insulin that stimulate antibody responses induced Th2 clones, whereas variants of insulin that fail to stimulate antibody induced Th0 clones. Th0 clones triggered delayed-type hypersensitivity (DTH) in adoptive recipients, whereas Th2 clones did not. Insulin variants that primed Th0 clones also directly primed for DTH responses, while variants that activated Th2 clones did not. Thus, induction of Th2 clones correlated with the ability of mice to make antibody responses to insulin while development of Th0 clones correlated with DTH responses and the failure to produce antibody. Copyright 1999 Academic Press.
Keywords: JOURNAL ARTICLE Adoptive Transfer Animal Cattle Cell Line Cytokines/BIOSYNTHESIS CD4-Positive T-Lymphocytes/CYTOLOGY/DRUG EFFECTS/*IMMUNOLOGY Hematopoietic Stem Cells/IMMUNOLOGY Human Hypersensitivity, Delayed Insulin/*IMMUNOLOGY/PHARMACOLOGY Mice Mice, Inbred C57BL Support, Non-U.S. Gov't Support, U.S. Gov't, P.H.S. Swine T-Lymphocyte Subsets/IMMUNOLOGY Th1 Cells/DRUG EFFECTS/IMMUNOLOGY Th2 Cells/DRUG EFFECTS/IMMUNOLOGYKWDjournalarticleadoptivetransferanimalcattlecelllinecytokines/biosynthesiscd4-positivet-lymphocytes/cytology/drugeffects/KWDimmunologyhematopoieticstemcells/immunologyhumanhypersensitivity,delayedinsulin/KWDimmunology/pharmacologymicemice,inbredc57blsupport,non-uKWDsKWDgov'tsupport,uKWDsKWDgov't,pKWDhKWDsKWDswinet-lymphocytesubsets/immunologyth1cells/drugeffects/immunologyth2cells/drugeffects/immunology
991230
A99C1001

Copyright © 1999 - National Library of Medicine. Reproduced under license with the National Library of Medicine, Bethesda, MD.

AEGiS is a 501(c)3, not-for-profit, tax-exempt, educational corporation. AEGiS is made possible through unrestricted funding from Boehringer Ingelheim, Bridgestone/Firestone Charitable Trust, Bristol-Myers Squibb Company, Elton John AIDS Foundation, Gill Foundation, the National Library of Medicine, Quest Diagnostics, Roche and Trimeris, and donations from users like you. Always watch for outdated information. This article first appeared in 1999. This material is designed to support, not replace, the relationship that exists between you and your doctor.

AEGiS presents published material, reprinted with permission and neither endorses nor opposes any material. All information contained on this website, including information relating to health conditions, products, and treatments, is for informational purposes only. It is often presented in summary or aggregate form. It is not meant to be a substitute for the advice provided by your own physician or other medical professionals. Always discuss treatment options with a doctor who specializes in treating HIV.

Copyright ©1980, 1999. AEGiS. All materials appearing on AEGiS are protected by copyright as a collective work or compilation under U.S. copyright and other laws and are the property of AEGiS, or the party credited as the provider of the content. .