A familial T-cell lymphoma with gamma delta phenotype and an original location. Possible role of chronic Epstein-Barr virus infection. NLM AIDSLINE Important note: Information in this article was accurate in 1996. The state of the art may have changed since the publication date.

Click here to return to AIDSLINE main menu
DonateNow
Print this Article


A familial T-cell lymphoma with gamma delta phenotype and an original location. Possible role of chronic Epstein-Barr virus infection.

Cancer. 1996 Apr 15;77(8):1571-7. Unique Identifier : AIDSLINE MED/96197464
Donadieu J; Canioni D; Cuenod B; Fraitag S; Bodemer C; Stephan JL; Sigaux F; Le Deist F; Schraub S; Ranfraing E; Griscelli C; Brousse N; Unite d'Immuno-Hematologie Pediatrique, Hopital Necker Enfants; Malades, Paris, France.


Abstract: BACKGROUND. We describe a familial lymphoproliferative syndrome associated with Epstein-Barr Virus (EBV) infection and the gamma delta phenotype. METHODS. We reviewed clinical, pathologic, immunologic, and virologic findings in a nonconsanguineous French family, collected over a 13-year period. Specimens from the father (autopsy), son (liver, lymph nodes, and pericardial effusion), and daughter (skin, liver, and digestive tract) were studied with conventional histologic and immunohistochemical techniques. Anti-EBV latent membrane protein (LMP) antibody and T-cell receptor (TCR) gene rearrangements were also studied in the daughter. RESULTS. The father and daughter had similar clinical and histologic features with maxilofacial, nasal, laryngeal, skin, lung, gastrointestinal, and liver involvement by a high grade large cell angiocentric T-cell lymphoma. The gamma delta phenotype and clonal rearrangement were identified in the daughter's tumor. At the time of his death from pericarditis, the son had a 5-year history of a recurrent hemophagocytic syndrome and lymphadenopathy. Chronic EBV infection was found in each case. EBV infection of the son was diagnosed by means of serologic tests and detection of the EBV genome in circulating lymphocytes, and in the father and daughter by use of an anti-LMP antibody. Its pathologic role is discussed. CONCLUSION. This familial T-cell lymphoma syndrome associated with the gamma delta phenotype and an unusual location is an original clinical entity. Chronic EBV infection was present in each case, but its precise role remains to be determined.
Keywords: Adult Case Report Child Child, Preschool Family Health Female Herpesviridae Infections/*PHYSIOPATHOLOGY *Herpesvirus 4, Human Human Lymphoma, T-Cell/*GENETICS/ULTRASTRUCTURE/*VIROLOGY Male Phenotype Receptors, Antigen, T-Cell, gamma-delta/*PHYSIOLOGY Tumor Virus Infections/*PHYSIOPATHOLOGY JOURNAL ARTICLEKWDadultcasereportchildchild,preschoolfamilyhealthfemaleherpesviridaeinfections/KWDphysiopathologyKWDherpesvirus4,humanhumanlymphoma,t-cell/KWDgenetics/ultrastructure/KWDvirologymalephenotypereceptors,antigen,t-cell,gamma-delta/KWDphysiologytumorvirusinfections/KWDphysiopathologyjournalarticle
960830
M9681215

Copyright © 1996 - National Library of Medicine. Reproduced under license with the National Library of Medicine, Bethesda, MD.

AEGiS is a 501(c)3, not-for-profit, tax-exempt, educational corporation. AEGiS is made possible through unrestricted funding from Boehringer Ingelheim, Bridgestone/Firestone Charitable Trust, Bristol-Myers Squibb Company, Elton John AIDS Foundation, Gill Foundation, the National Library of Medicine, Quest Diagnostics, Roche and Trimeris, and donations from users like you. Always watch for outdated information. This article first appeared in 1996. This material is designed to support, not replace, the relationship that exists between you and your doctor.

AEGiS presents published material, reprinted with permission and neither endorses nor opposes any material. All information contained on this website, including information relating to health conditions, products, and treatments, is for informational purposes only. It is often presented in summary or aggregate form. It is not meant to be a substitute for the advice provided by your own physician or other medical professionals. Always discuss treatment options with a doctor who specializes in treating HIV.

Copyright ©1980, 1996. AEGiS. All materials appearing on AEGiS are protected by copyright as a collective work or compilation under U.S. copyright and other laws and are the property of AEGiS, or the party credited as the provider of the content. .